Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries) |
Domain d4cfef2: 4cfe F:183-325 [251373] automated match to d2v8qe1 complexed with 992, amp, stu |
PDB Entry: 4cfe (more details), 3.02 Å
SCOPe Domain Sequences for d4cfef2:
Sequence, based on SEQRES records: (download)
>d4cfef2 d.37.1.1 (F:183-325) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv vdendvvkgivslsdilqalvlt
>d4cfef2 d.37.1.1 (F:183-325) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys kfdvinlaaektynnldvsvtkalqhrsvlkcylhetletiinrlveaevhrlvvvdend vvkgivslsdilqalvlt
Timeline for d4cfef2: