Lineage for d4cfef2 (4cfe F:183-325)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645809Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1645810Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1645811Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1645937Protein automated matches [190627] (6 species)
    not a true protein
  7. 1645958Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries)
  8. 1645967Domain d4cfef2: 4cfe F:183-325 [251373]
    automated match to d2v8qe1
    complexed with 992, amp, stu

Details for d4cfef2

PDB Entry: 4cfe (more details), 3.02 Å

PDB Description: structure of full length human ampk in complex with a small molecule activator, a benzimidazole derivative (991)
PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d4cfef2:

Sequence, based on SEQRES records: (download)

>d4cfef2 d.37.1.1 (F:183-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvlt

Sequence, based on observed residues (ATOM records): (download)

>d4cfef2 d.37.1.1 (F:183-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrsvlkcylhetletiinrlveaevhrlvvvdend
vvkgivslsdilqalvlt

SCOPe Domain Coordinates for d4cfef2:

Click to download the PDB-style file with coordinates for d4cfef2.
(The format of our PDB-style files is described here.)

Timeline for d4cfef2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cfef1