SCOPe 2.08: Domain d4cfef1: 4cfe F:27-182

Lineage for d4cfef1 (4cfe F:27-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries)

8. Domain d4cfef1: 4cfe F:27-182 [251372]
   automated match to d2v8qe2
   complexed with 992, amp, stu

Details for d4cfef1

PDB Entry: 4cfe, 3.02 Å

PDB Description: structure of full length human ampk in complex with a small molecule activator, a benzimidazole derivative (991)

PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d4cfef1:

Sequence, based on SEQRES records:

>d4cfef1 d.37.1.1 (F:27-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
titdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssli
rnkihrlpvidpesgntlyilthkrilkflklfite

Sequence, based on observed residues (ATOM records):

>d4cfef1 d.37.1.1 (F:27-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgml
titdfinilhryyksalvqiyeleehkietwrevyplvcispnaslfdavsslirnkihr
lpvidpesgntlyilthkrilkflklfite

Timeline for d4cfef1:

• d4cfef1 first appeared in SCOPe 2.04
  
• d4cfef1 appears in SCOPe 2.07