Lineage for d1ptoe_ (1pto E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788563Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 2788564Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 2788574Domain d1ptoe_: 1pto E: [25137]
    Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_

Details for d1ptoe_

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
PDB Compounds: (E:) pertussis toxin (subunit s4)

SCOPe Domain Sequences for d1ptoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptoe_ b.40.2.1 (E:) Pertussis toxin S4 subunit {Bordetella pertussis [TaxId: 520]}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOPe Domain Coordinates for d1ptoe_:

Click to download the PDB-style file with coordinates for d1ptoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ptoe_: