SCOPe 2.06: Domain d4ccga1: 4ccg A:1-153

Lineage for d4ccga1 (4ccg A:1-153)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d4ccga1: 4ccg A:1-153 [251362]
   Other proteins in same PDB: d4ccga2, d4ccgb2
   automated match to d1yh2a1
   complexed with cl, epe, gol, na, nh4, so4, zn

Details for d4ccga1

PDB Entry: 4ccg, 2.4 Å

PDB Description: Structure of an E2-E3 complex

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 t

SCOPe Domain Sequences for d4ccga1:

Sequence; same for both SEQRES and ATOM records:

>d4ccga1 d.20.1.1 (A:1-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqrasrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviiper
ypfeppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsepnp
ddplmadissefkynkpaflknarqwtekharq

Timeline for d4ccga1:

• d4ccga1 first appeared in SCOPe 2.04, called d4ccga_
  
• d4ccga1 was called d4ccga_ in SCOPe 2.05
  
• d4ccga1 appears in SCOPe 2.07
  
• d4ccga1 appears in the current release, SCOPe 2.08