SCOPe 2.06: Domain d1ptod_: 1pto D:

Lineage for d1ptod_ (1pto D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Pertussis toxin S4 subunit [50215] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)

8. Domain d1ptod_: 1pto D: [25136]
   Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_

Details for d1ptod_

PDB Entry: 1pto, 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

PDB Compounds: (D:) pertussis toxin (subunit s4)

SCOPe Domain Sequences for d1ptod_:

Sequence; same for both SEQRES and ATOM records:

>d1ptod_ b.40.2.1 (D:) Pertussis toxin S4 subunit {Bordetella pertussis [TaxId: 520]}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

Timeline for d1ptod_:

• d1ptod_ first appeared (with stable ids) in SCOP 1.55
  
• d1ptod_ appears in SCOPe 2.05
  
• d1ptod_ appears in SCOPe 2.07
  
• d1ptod_ appears in the current release, SCOPe 2.08