SCOPe 2.08: Domain d4c9if1: 4c9i F:2-160

Lineage for d4c9if1 (4c9i F:2-160)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)

8. Domain d4c9if1: 4c9i F:2-160 [251358]
   Other proteins in same PDB: d4c9ia2, d4c9ib2, d4c9ic2, d4c9id2, d4c9ie2, d4c9if2
   automated match to d4c9ca_
   complexed with gol, kxn

Details for d4c9if1

PDB Entry: 4c9i, 3.1 Å

PDB Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form B)

PDB Compounds: (F:) Major strawberry allergen Fra a 1-E

SCOPe Domain Sequences for d4c9if1:

Sequence; same for both SEQRES and ATOM records:

>d4c9if1 d.129.3.0 (F:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge
gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky
htkgdveikeehvkagkekaahlfkliegylkdhpseyn

Timeline for d4c9if1:

• d4c9if1 first appeared in SCOPe 2.04, called d4c9if_
  
• d4c9if1 appears in SCOPe 2.07