Lineage for d4c9ie1 (4c9i E:2-160)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582531Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)
  8. 2582538Domain d4c9ie1: 4c9i E:2-160 [251357]
    Other proteins in same PDB: d4c9ia2, d4c9ib2, d4c9ic2, d4c9id2, d4c9ie2, d4c9if2
    automated match to d4c9ca_
    complexed with gol, kxn

Details for d4c9ie1

PDB Entry: 4c9i (more details), 3.1 Å

PDB Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form B)
PDB Compounds: (E:) Major strawberry allergen Fra a 1-E

SCOPe Domain Sequences for d4c9ie1:

Sequence, based on SEQRES records: (download)

>d4c9ie1 d.129.3.0 (E:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge
gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky
htkgdveikeehvkagkekaahlfkliegylkdhpseyn

Sequence, based on observed residues (ATOM records): (download)

>d4c9ie1 d.129.3.0 (E:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfgy
gyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyhtkg
dveikeehvkagkekaahlfkliegylkdhpseyn

SCOPe Domain Coordinates for d4c9ie1:

Click to download the PDB-style file with coordinates for d4c9ie1.
(The format of our PDB-style files is described here.)

Timeline for d4c9ie1: