| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (21 species) not a true protein |
| Species Fragaria x [TaxId:3747] [228292] (4 PDB entries) |
| Domain d4c9ib1: 4c9i B:2-160 [251354] Other proteins in same PDB: d4c9ia2, d4c9ib2, d4c9ic2, d4c9id2, d4c9ie2, d4c9if2 automated match to d4c9ca_ complexed with gol, kxn |
PDB Entry: 4c9i (more details), 3.1 Å
SCOPe Domain Sequences for d4c9ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9ib1 d.129.3.0 (B:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge
gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky
htkgdveikeehvkagkekaahlfkliegylkdhpseyn
Timeline for d4c9ib1: