Lineage for d4c94d1 (4c94 D:2-159)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582531Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)
  8. 2582543Domain d4c94d1: 4c94 D:2-159 [251351]
    Other proteins in same PDB: d4c94a2, d4c94b2, d4c94c2, d4c94d2, d4c94e2
    automated match to d4c9ca_
    complexed with kxn

Details for d4c94d1

PDB Entry: 4c94 (more details), 3 Å

PDB Description: crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 3 protein in complex with catechin
PDB Compounds: (D:) fra a 3 allergen

SCOPe Domain Sequences for d4c94d1:

Sequence, based on SEQRES records: (download)

>d4c94d1 d.129.3.0 (D:2-159) automated matches {Fragaria x [TaxId: 3747]}
gvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkihlge
gseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiikstshyh
tkgeveikeehvkagkeraaglfkiienhllahpeeyn

Sequence, based on observed residues (ATOM records): (download)

>d4c94d1 d.129.3.0 (D:2-159) automated matches {Fragaria x [TaxId: 3747]}
gvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkihlgs
yvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiikstshyhtkgev
eikeehvkagkeraaglfkiienhllahpeeyn

SCOPe Domain Coordinates for d4c94d1:

Click to download the PDB-style file with coordinates for d4c94d1.
(The format of our PDB-style files is described here.)

Timeline for d4c94d1: