Lineage for d1bcpk_ (1bcp K:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559070Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 559345Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 559346Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 559354Domain d1bcpk_: 1bcp K: [25135]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_
    complexed with atp

Details for d1bcpk_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpk_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOP Domain Coordinates for d1bcpk_:

Click to download the PDB-style file with coordinates for d1bcpk_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpk_: