Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Pertussis toxin S4 subunit [50215] (1 species) |
Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries) |
Domain d1bcpk_: 1bcp K: [25135] Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_ complexed with atp |
PDB Entry: 1bcp (more details), 2.7 Å
SCOP Domain Sequences for d1bcpk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcpk_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis} dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
Timeline for d1bcpk_: