SCOPe 2.04: Domain d4c94a_: 4c94 A:

Lineage for d4c94a_ (4c94 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)

8. Domain d4c94a_: 4c94 A: [251348]
   automated match to d4c9ca_
   complexed with kxn

Details for d4c94a_

PDB Entry: 4c94, 3 Å

PDB Description: crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 3 protein in complex with catechin

PDB Compounds: (A:) fra a 3 allergen

SCOPe Domain Sequences for d4c94a_:

Sequence; same for both SEQRES and ATOM records:

>d4c94a_ d.129.3.0 (A:) automated matches {Fragaria x [TaxId: 3747]}
amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn

Timeline for d4c94a_:

• d4c94a_ is new in SCOPe 2.04-stable
  
• d4c94a_ appears in SCOPe 2.05
  
• d4c94a_ appears in the current release, SCOPe 2.08, called d4c94a1