Lineage for d4c94a_ (4c94 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669378Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1669379Protein automated matches [190218] (19 species)
    not a true protein
  7. 1669450Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)
  8. 1669453Domain d4c94a_: 4c94 A: [251348]
    automated match to d4c9ca_
    complexed with kxn

Details for d4c94a_

PDB Entry: 4c94 (more details), 3 Å

PDB Description: crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 3 protein in complex with catechin
PDB Compounds: (A:) fra a 3 allergen

SCOPe Domain Sequences for d4c94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c94a_ d.129.3.0 (A:) automated matches {Fragaria x [TaxId: 3747]}
amagvftyeseftsvipppklfkafvldadnlipkiapqavksaeiiegdggvgtikkih
lgegseysyvkhkidgidkdnfvysysiiegdaigdkiekisyeiklvasgggsiiksts
hyhtkgeveikeehvkagkeraaglfkiienhllahpeeyn

SCOPe Domain Coordinates for d4c94a_:

Click to download the PDB-style file with coordinates for d4c94a_.
(The format of our PDB-style files is described here.)

Timeline for d4c94a_: