Lineage for d4c7qa_ (4c7q A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909138Species Tobacco (Nicotiana tabacum) [TaxId:4097] [256225] (1 PDB entry)
  8. 1909139Domain d4c7qa_: 4c7q A: [251346]
    automated match to d2cqba1

Details for d4c7qa_

PDB Entry: 4c7q (more details)

PDB Description: Solution structure of the Nt. GR-RBP1 RRM domain
PDB Compounds: (A:) RNA-binding glycine-rich protein

SCOPe Domain Sequences for d4c7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7qa_ d.58.7.0 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
gmaeveyrcfvgglawattdqtlgeafsqfgeildskiindretgrsrgfgfvtfkdeka
mrdaiegmngqdldgrnitvneaqsr

SCOPe Domain Coordinates for d4c7qa_:

Click to download the PDB-style file with coordinates for d4c7qa_.
(The format of our PDB-style files is described here.)

Timeline for d4c7qa_: