![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) ![]() contains a single copy of this fold decorated with additional structures |
![]() | Family d.129.9.1: RalF, C-terminal domain [118105] (2 proteins) |
![]() | Protein automated matches [254743] (2 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:272624] [256227] (1 PDB entry) |
![]() | Domain d4c7pa2: 4c7p A:198-347 [251345] Other proteins in same PDB: d4c7pa1, d4c7pa3 automated match to d1xsza2 complexed with gol; mutant |
PDB Entry: 4c7p (more details), 3.1 Å
SCOPe Domain Sequences for d4c7pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7pa2 d.129.9.1 (A:198-347) automated matches {Legionella pneumophila [TaxId: 272624]} ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfktg ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss pvknfkatydyevgdlikaydnqkklitie
Timeline for d4c7pa2: