Lineage for d4c7pa2 (4c7p A:198-347)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669625Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) (S)
    contains a single copy of this fold decorated with additional structures
  5. 1669626Family d.129.9.1: RalF, C-terminal domain [118105] (2 proteins)
  6. 1669631Protein automated matches [254743] (1 species)
    not a true protein
  7. 1669632Species Legionella pneumophila [TaxId:272624] [256227] (1 PDB entry)
  8. 1669633Domain d4c7pa2: 4c7p A:198-347 [251345]
    Other proteins in same PDB: d4c7pa1
    automated match to d1xsza2
    complexed with gol; mutant

Details for d4c7pa2

PDB Entry: 4c7p (more details), 3.1 Å

PDB Description: Crystal structure of Legionella pneumophila RalF F255K mutant
PDB Compounds: (A:) ralf

SCOPe Domain Sequences for d4c7pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7pa2 d.129.9.1 (A:198-347) automated matches {Legionella pneumophila [TaxId: 272624]}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfktg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitie

SCOPe Domain Coordinates for d4c7pa2:

Click to download the PDB-style file with coordinates for d4c7pa2.
(The format of our PDB-style files is described here.)

Timeline for d4c7pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c7pa1