![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
![]() | Protein automated matches [194433] (2 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:272624] [256226] (1 PDB entry) |
![]() | Domain d4c7pa1: 4c7p A:2-197 [251344] Other proteins in same PDB: d4c7pa2, d4c7pa3 automated match to d1xsza1 complexed with gol; mutant |
PDB Entry: 4c7p (more details), 3.1 Å
SCOPe Domain Sequences for d4c7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7pa1 a.118.3.1 (A:2-197) automated matches {Legionella pneumophila [TaxId: 272624]} hpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgdy lsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfqq npdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfle elyseikakpfelnfv
Timeline for d4c7pa1: