Lineage for d4c7pa1 (4c7p A:2-197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726246Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2726276Protein automated matches [194433] (2 species)
    not a true protein
  7. 2726281Species Legionella pneumophila [TaxId:272624] [256226] (1 PDB entry)
  8. 2726282Domain d4c7pa1: 4c7p A:2-197 [251344]
    Other proteins in same PDB: d4c7pa2, d4c7pa3
    automated match to d1xsza1
    complexed with gol; mutant

Details for d4c7pa1

PDB Entry: 4c7p (more details), 3.1 Å

PDB Description: Crystal structure of Legionella pneumophila RalF F255K mutant
PDB Compounds: (A:) ralf

SCOPe Domain Sequences for d4c7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7pa1 a.118.3.1 (A:2-197) automated matches {Legionella pneumophila [TaxId: 272624]}
hpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgdy
lsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfqq
npdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfle
elyseikakpfelnfv

SCOPe Domain Coordinates for d4c7pa1:

Click to download the PDB-style file with coordinates for d4c7pa1.
(The format of our PDB-style files is described here.)

Timeline for d4c7pa1: