Lineage for d1bcpj_ (1bcp J:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374222Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 374223Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 374230Domain d1bcpj_: 1bcp J: [25134]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_

Details for d1bcpj_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpj_ b.40.2.1 (J:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOP Domain Coordinates for d1bcpj_:

Click to download the PDB-style file with coordinates for d1bcpj_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpj_: