![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
![]() | Protein automated matches [191104] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [228914] (2 PDB entries) |
![]() | Domain d4c51a1: 4c51 A:24-432 [251339] automated match to d4c50a1 complexed with glc, hem; mutant |
PDB Entry: 4c51 (more details), 3.1 Å
SCOPe Domain Sequences for d4c51a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c51a1 a.93.1.0 (A:24-432) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ghmkypvegggnqdwwpnrlnlkvlhqnpavadpmgaafdyaaevatidvdaltrdieev mttsqpwwpadyghygplfirmawhaagtyrihdgrggagggmqrfaplnswpdnasldk arrllwpvkkkygkklswadlivfagncalesmgfktfgfgfgrvdqwepdevywgkeat wlgderysgkrdlenplaavqmgliyvnpegpngnpdpmaaavdiretfrrmamndveta alivgghtfgkthgagpadlvgpepeaapleqmglgwkssygtgtgkdaitsgievvwtn tptkwdnsfleilygyeweltkspagawqytakdgagagtipdpfggpgrsptmlatdls lrvdpiyeritrrwlehpeeladefakawyklihldmgpvarylgplvp
Timeline for d4c51a1: