Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.0: automated matches [254324] (1 protein) not a true family |
Protein automated matches [254742] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256218] (2 PDB entries) |
Domain d4c3ik_: 4c3i K: [251337] Other proteins in same PDB: d4c3ie1, d4c3ie2, d4c3if_, d4c3ih_, d4c3ij_, d4c3il_ automated match to d1twfk_ complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3ik_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3ik_ d.74.3.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eepdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsen llniriqtygettavdalqkglkdlmdlcdvveskftekiksm
Timeline for d4c3ik_: