Lineage for d4c3ik_ (4c3i K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958305Family d.74.3.0: automated matches [254324] (1 protein)
    not a true family
  6. 2958306Protein automated matches [254742] (3 species)
    not a true protein
  7. 2958307Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256218] (2 PDB entries)
  8. 2958310Domain d4c3ik_: 4c3i K: [251337]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3il_, d4c3im_, d4c3in_
    automated match to d1twfk_
    complexed with mg, mpd, so4, zn

Details for d4c3ik_

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (K:) DNA-directed RNA polymerases I and III subunit rpac2

SCOPe Domain Sequences for d4c3ik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3ik_ d.74.3.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eepdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsen
llniriqtygettavdalqkglkdlmdlcdvveskftekiksm

SCOPe Domain Coordinates for d4c3ik_:

Click to download the PDB-style file with coordinates for d4c3ik_.
(The format of our PDB-style files is described here.)

Timeline for d4c3ik_: