Lineage for d4c3ij_ (4c3i J:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480666Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1480667Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1480704Protein automated matches [190336] (3 species)
    not a true protein
  7. 1480713Species Saccharomyces cerevisiae [TaxId:764097] [256224] (1 PDB entry)
  8. 1480714Domain d4c3ij_: 4c3i J: [251336]
    Other proteins in same PDB: d4c3ie1, d4c3ie2, d4c3if_, d4c3ih_, d4c3ik_, d4c3il_
    automated match to d1twfj_
    complexed with mg, mpd, so4, zn

Details for d4c3ij_

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit rpabc 5

SCOPe Domain Sequences for d4c3ij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3ij_ a.4.11.1 (J:) automated matches {Saccharomyces cerevisiae}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynplekr

SCOPe Domain Coordinates for d4c3ij_:

Click to download the PDB-style file with coordinates for d4c3ij_.
(The format of our PDB-style files is described here.)

Timeline for d4c3ij_: