| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (2 proteins) |
| Protein automated matches [254699] (5 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:764097] [256220] (1 PDB entry) |
| Domain d4c3if_: 4c3i F: [251334] Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_ automated match to d4c2mf_ complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3if_ a.143.1.2 (F:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
tdplriamkelaekkiplvirrylpdgsfedwsveelivd
Timeline for d4c3if_: