Lineage for d4c3if_ (4c3i F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734842Protein automated matches [254699] (5 species)
    not a true protein
  7. 2734851Species Saccharomyces cerevisiae [TaxId:764097] [256220] (1 PDB entry)
  8. 2734852Domain d4c3if_: 4c3i F: [251334]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_
    automated match to d4c2mf_
    complexed with mg, mpd, so4, zn

Details for d4c3if_

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit rpabc 2

SCOPe Domain Sequences for d4c3if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3if_ a.143.1.2 (F:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
tdplriamkelaekkiplvirrylpdgsfedwsveelivd

SCOPe Domain Coordinates for d4c3if_:

Click to download the PDB-style file with coordinates for d4c3if_.
(The format of our PDB-style files is described here.)

Timeline for d4c3if_: