![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) ![]() automatically mapped to Pfam PF01191 |
![]() | Family d.78.1.0: automated matches [254302] (1 protein) not a true family |
![]() | Protein automated matches [254702] (3 species) not a true protein |
![]() | Species Saccharomyces cerevisiae [TaxId:764097] [256222] (1 PDB entry) |
![]() | Domain d4c3ie2: 4c3i E:144-215 [251333] Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_ automated match to d1dzfa2 complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3ie2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3ie2 d.78.1.0 (E:144-215) automated matches {Saccharomyces cerevisiae [TaxId: 764097]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d4c3ie2: