SCOPe 2.04: Domain d4c3ie2: 4c3i E:144-215

Lineage for d4c3ie2 (4c3i E:144-215)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.0: automated matches [254302] (1 protein)
   not a true family

6. Protein automated matches [254702] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [256222] (1 PDB entry)

8. Domain d4c3ie2: 4c3i E:144-215 [251333]
   Other proteins in same PDB: d4c3ie1, d4c3if_, d4c3ih_, d4c3ij_, d4c3ik_, d4c3il_
   automated match to d1dzfa2
   complexed with mg, mpd, so4, zn

Details for d4c3ie2

PDB Entry: 4c3i, 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c3ie2:

Sequence; same for both SEQRES and ATOM records:

>d4c3ie2 d.78.1.0 (E:144-215) automated matches {Saccharomyces cerevisiae}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d4c3ie2:

• d4c3ie2 is new in SCOPe 2.04-stable
  
• d4c3ie2 appears in SCOPe 2.05
  
• d4c3ie2 appears in the current release, SCOPe 2.08