SCOPe 2.04: Domain d4c3ie1: 4c3i E:1-143

Lineage for d4c3ie1 (4c3i E:1-143)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein automated matches [254701] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [256221] (1 PDB entry)

8. Domain d4c3ie1: 4c3i E:1-143 [251332]
   Other proteins in same PDB: d4c3ie2, d4c3if_, d4c3ih_, d4c3ij_, d4c3ik_, d4c3il_
   automated match to d1dzfa1
   complexed with mg, mpd, so4, zn

Details for d4c3ie1

PDB Entry: 4c3i, 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c3ie1:

Sequence; same for both SEQRES and ATOM records:

>d4c3ie1 c.52.3.1 (E:1-143) automated matches {Saccharomyces cerevisiae}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d4c3ie1:

• d4c3ie1 is new in SCOPe 2.04-stable
  
• d4c3ie1 appears in SCOPe 2.05
  
• d4c3ie1 appears in the current release, SCOPe 2.08