Lineage for d4c3ie1 (4c3i E:1-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882964Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2882965Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2882999Protein automated matches [254701] (3 species)
    not a true protein
  7. 2883006Species Saccharomyces cerevisiae [TaxId:764097] [256221] (1 PDB entry)
  8. 2883007Domain d4c3ie1: 4c3i E:1-143 [251332]
    Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ij_, d4c3ik_, d4c3il_, d4c3im_, d4c3in_
    automated match to d1dzfa1
    complexed with mg, mpd, so4, zn

Details for d4c3ie1

PDB Entry: 4c3i (more details), 3 Å

PDB Description: structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c3ie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3ie1 c.52.3.1 (E:1-143) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOPe Domain Coordinates for d4c3ie1:

Click to download the PDB-style file with coordinates for d4c3ie1.
(The format of our PDB-style files is described here.)

Timeline for d4c3ie1: