Lineage for d4c2la_ (4c2l A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069351Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 2069352Protein automated matches [190791] (5 species)
    not a true protein
  7. 2069364Species Aspergillus tubingensis [TaxId:5068] [256219] (1 PDB entry)
  8. 2069365Domain d4c2la_: 4c2l A: [251331]
    automated match to d1hg8a_
    complexed with gol, man, nag, so4

Details for d4c2la_

PDB Entry: 4c2l (more details), 1.75 Å

PDB Description: Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis
PDB Compounds: (A:) endo-xylogalacturonan hydrolase a

SCOPe Domain Sequences for d4c2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2la_ b.80.1.0 (A:) automated matches {Aspergillus tubingensis [TaxId: 5068]}
avctptaggdsstddvpaitealsscgnggtivfpegstyylnsvldlgscsdcdiqveg
llkfasdtdywsgrtamisvsnvdglklrsltgsgvidgngqdawdlfasdssysrptll
yitggsnleisglrqknppnvfnsvkggatnvvfsnlkmdansksdnppkntdgfdiges
tyvtitevtvvndddcvafkpssnyvtvdtisctgshgisvgslgkssddsvkniyvtga
tminstkaagiktypsggdhgtstvsnvtfndftvdnsdyafqiqscygedddyceenpg
nakltdivvssfsgttsdkydpvvanldcgadgtcgisisgfdvkapsgksevlcantps
dlgvtctsgasg

SCOPe Domain Coordinates for d4c2la_:

Click to download the PDB-style file with coordinates for d4c2la_.
(The format of our PDB-style files is described here.)

Timeline for d4c2la_: