Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) |
Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins) |
Protein automated matches [254740] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256212] (1 PDB entry) |
Domain d4brya_: 4bry A: [251320] Other proteins in same PDB: d4bryb_ automated match to d2zxxb_ complexed with pg4, po4 |
PDB Entry: 4bry (more details), 2.89 Å
SCOPe Domain Sequences for d4brya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4brya_ h.1.28.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym aelierlng
Timeline for d4brya_: