Lineage for d4brya_ (4bry A:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709312Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. 1709313Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. 1709325Protein automated matches [254740] (1 species)
    not a true protein
  7. 1709326Species Human (Homo sapiens) [TaxId:9606] [256212] (1 PDB entry)
  8. 1709327Domain d4brya_: 4bry A: [251320]
    Other proteins in same PDB: d4bryb_
    automated match to d2zxxb_
    complexed with pg4, po4

Details for d4brya_

PDB Entry: 4bry (more details), 2.89 Å

PDB Description: The Idas:Geminin heterodimeric parallel coiled-coil
PDB Compounds: (A:) Geminin

SCOPe Domain Sequences for d4brya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4brya_ h.1.28.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
aelierlng

SCOPe Domain Coordinates for d4brya_:

Click to download the PDB-style file with coordinates for d4brya_.
(The format of our PDB-style files is described here.)

Timeline for d4brya_: