Lineage for d4bqza2 (4bqz A:179-462)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2123164Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 protein domains)
    Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329
  6. 2123175Protein automated matches [254739] (1 species)
    not a true protein
  7. 2123176Species Norway rat (Rattus norvegicus) [TaxId:10116] [256211] (6 PDB entries)
  8. 2123181Domain d4bqza2: 4bqz A:179-462 [251313]
    Other proteins in same PDB: d4bqza1
    automated match to d3cj7a2
    complexed with gnp, gol, mg

Details for d4bqza2

PDB Entry: 4bqz (more details), 2.05 Å

PDB Description: Rat NTPDase2 in complex with Mg GMPPNP
PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d4bqza2:

Sequence, based on SEQRES records: (download)

>d4bqza2 c.55.1.15 (A:179-462) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqrprafngsai
vslsgtsnatlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttv
mglpvgtlkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfder
sfrevvfqkkaadtavgwalgymlnltnlipadlpglrkgthfs

Sequence, based on observed residues (ATOM records): (download)

>d4bqza2 c.55.1.15 (A:179-462) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nfikygwvgrwirprkgtlgamdlggastqitfettspsedpgnevhlrlygqhyrvyth
sflcygrdqillrllasalqihrfhpcwpkgystqvllqevyqspctmgqsaivslsgts
natlcrdlvsrlfnisscpfsqcsfngvfqppvagnfiafsafyytvdflttvmglpvgt
lkqleeateitcnqtwtelqarvpgqktrladycavamfihqllsrgyhfdersfrevvf
qkkaadtavgwalgymlnltnlipadlpglrkgthfs

SCOPe Domain Coordinates for d4bqza2:

Click to download the PDB-style file with coordinates for d4bqza2.
(The format of our PDB-style files is described here.)

Timeline for d4bqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bqza1