Lineage for d4bqka_ (4bqk A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelixSuperfamily a.118.1: ARM repeat [48371] (26 families) 
Family a.118.1.0: automated matches [191340] (1 protein)
not a true familyProtein automated matches [190220] (12 species)
not a true protein
Species Rice (Oryza sativa) [TaxId:4530] [256208] (2 PDB entries) 
Domain d4bqka_: 4bqk A: [251302]
automated match to d1y2ac_
complexed with peg
Details for d4bqka_
PDB Entry: 4bqk (more details), 2 Å
PDB Description: rice importin_alpha : VirD2NLS complex
PDB Compounds: (A:) importin subunit alpha-1aSCOPe Domain Sequences for d4bqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bqka_ a.118.1.0 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
gsslpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfp
qlqfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdsp
kcrdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarl
ihsndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgn
ivtgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagi
igplvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivt
vcleglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkile
aywm
SCOPe Domain Coordinates for d4bqka_:
Click to download the PDB-style file with coordinates for d4bqka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bqka_:
- d4bqka_ first appeared in SCOPe 2.04
- d4bqka_ is called d4bqka1 in SCOPe 2.06
- d4bqka_ appears in the current release, SCOPe 2.08, called d4bqka1
View in 3D
