Lineage for d4bqfa_ (4bqf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142613Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256209] (8 PDB entries)
  8. 2142618Domain d4bqfa_: 4bqf A: [251298]
    automated match to d3amva_
    complexed with glc, gol, plp, qps

Details for d4bqfa_

PDB Entry: 4bqf (more details), 2.35 Å

PDB Description: Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose
PDB Compounds: (A:) alpha-glucan phosphorylase 2, cytosolic

SCOPe Domain Sequences for d4bqfa_:

Sequence, based on SEQRES records: (download)

>d4bqfa_ c.87.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kisakanpeaddateiagnivyhakysphfsplkfgpeqalyataeslrdrliqlwnety
vhfnkvdpkqtyylsmeylqgraltnaignlnlqgpyadalrtlgyeleeiaeqekdaal
gngglgrlascfldsmatlnlpawgyglryrhglfkqiitkkgqeeipedwlekfspwei
vrhdvvfpvrffgkvqvnpdgsrkwvdgdvvqalaydvpipgygtkntislrlweakara
edldlfqfnegeyelaaqlhsraqqictvlypgdatengkllrlkqqfflcsaslqdiis
rfhersttegsrkwsefpskvavqmndthptlaipelmrllmddnglgwdeawdvtsktv
aytnhtvlpealekwsqslmwkllprhmeiieeidkrfvqtirdtrvdledkisslsild
nnpqkpvvrmanlcvvsshtvngvaqlhsdilkaelfadyvsiwpnkfqnktngitprrw
lrfcspelsdiitkwlktdkwitdldlltglrqfadneelqsewasaktankkrlaqyie
rvtgvsidptslfdiqvkriheykrqlmnilgvvyrfkklkemkpeerkktvprtvmigg
kafatytnakrivklvndvgdvvnsdpevneylkvvfvpnynvtvaemlipgselsqhis
tagmeasgtsnmkfalngcliigtldganveireevgeenfflfgatadqvprlrkered
glfkpdprfeeakqfvksgvfgsydygplldslegntgfgrgdyflvgydfpsymdaqak
vdeaykdrkgwlkmsilstagsgkfssdrtiaqyakeiwnieacpvp

Sequence, based on observed residues (ATOM records): (download)

>d4bqfa_ c.87.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kisakanpeaddateiagnivyhakysphfsplkfgpeqalyataeslrdrliqlwnety
vhfnkvdpkqtyylsmeylqgraltnaignlnlqgpyadalrtlgyeleeiaeqekdaal
gngglgrlascfldsmatlnlpawgyglryrhglfkqiitkkgqeeipedwlekfspwei
vrhdvvfpvrffgkvqvnpdgsrkwvdgdvvqalaydvpipgygtkntislrlweakara
edldlfqfnegeyelaaqlhsraqqictvlypgdatengkllrlkqqfflcsaslqdiis
rfhersttrkwsefpskvavqmndthptlaipelmrllmddnglgwdeawdvtsktvayt
nhtvlpealekwsqslmwkllprhmeiieeidkrfvqtirdtrvdledkisslsildnnp
qkpvvrmanlcvvsshtvngvaqlhsdilkaelfadyvsiwpnkfqnktngitprrwlrf
cspelsdiitkwlktdkwitdldlltglrqfadneelqsewasaktankkrlaqyiervt
gvsidptslfdiqvkriheykrqlmnilgvvyrfkklkemkpeerkktvprtvmiggkaf
atytnakrivklvndvgdvvnsdpevneylkvvfvpnynvtvaemlipgselsqhistag
measgtsnmkfalngcliigtldganveireevgeenfflfgatadqvprlrkeredglf
kpdprfeeakqfvksgvfgsydygplldslegntgfgrgdyflvgydfpsymdaqakvde
aykdrkgwlkmsilstagsgkfssdrtiaqyakeiwnieacpvp

SCOPe Domain Coordinates for d4bqfa_:

Click to download the PDB-style file with coordinates for d4bqfa_.
(The format of our PDB-style files is described here.)

Timeline for d4bqfa_: