Lineage for d4bmtb_ (4bmt B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317233Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries)
  8. 2317243Domain d4bmtb_: 4bmt B: [251289]
    automated match to d2r2fa_
    complexed with fe2

Details for d4bmtb_

PDB Entry: 4bmt (more details), 2.1 Å

PDB Description: Crystal Structure of Ribonucleotide Reductase di-iron NrdF from Bacillus cereus
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4bmtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmtb_ a.25.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlngl

SCOPe Domain Coordinates for d4bmtb_:

Click to download the PDB-style file with coordinates for d4bmtb_.
(The format of our PDB-style files is described here.)

Timeline for d4bmtb_: