![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (29 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries) |
![]() | Domain d4bmrb_: 4bmr B: [251287] automated match to d2r2fa_ complexed with fe2 |
PDB Entry: 4bmr (more details), 2 Å
SCOPe Domain Sequences for d4bmrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bmrb_ a.25.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]} mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr
Timeline for d4bmrb_: