Lineage for d4bmrb_ (4bmr B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486350Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries)
  8. 1486356Domain d4bmrb_: 4bmr B: [251287]
    automated match to d2r2fa_
    complexed with fe2

Details for d4bmrb_

PDB Entry: 4bmr (more details), 2 Å

PDB Description: Crystal Structure of Ribonucleotide Reductase apo-NrdF from Bacillus cereus (space group P21)
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4bmrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmrb_ a.25.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr

SCOPe Domain Coordinates for d4bmrb_:

Click to download the PDB-style file with coordinates for d4bmrb_.
(The format of our PDB-style files is described here.)

Timeline for d4bmrb_: