SCOPe 2.08: Domain d4bmrb_: 4bmr B:

Lineage for d4bmrb_ (4bmr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries)

8. Domain d4bmrb_: 4bmr B: [251287]
   automated match to d2r2fa_
   complexed with fe2

Details for d4bmrb_

PDB Entry: 4bmr, 2 Å

PDB Description: Crystal Structure of Ribonucleotide Reductase apo-NrdF from Bacillus cereus (space group P21)

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4bmrb_:

Sequence; same for both SEQRES and ATOM records:

>d4bmrb_ a.25.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglr

Timeline for d4bmrb_:

• d4bmrb_ first appeared in SCOPe 2.04
  
• d4bmrb_ appears in SCOPe 2.07