Lineage for d4bmoa_ (4bmo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317233Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries)
  8. 2317234Domain d4bmoa_: 4bmo A: [251282]
    automated match to d2r2fa_
    complexed with cl, fe2, fmn

Details for d4bmoa_

PDB Entry: 4bmo (more details), 1.81 Å

PDB Description: Crystal Structure of Bacillus cereus Ribonucleotide Reductase di- iron NrdF in Complex with NrdI (1.8 A resolution)
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4bmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmoa_ a.25.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglrtd

SCOPe Domain Coordinates for d4bmoa_:

Click to download the PDB-style file with coordinates for d4bmoa_.
(The format of our PDB-style files is described here.)

Timeline for d4bmoa_: