SCOPe 2.04: Domain d4bmoa_: 4bmo A:

Lineage for d4bmoa_ (4bmo A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (29 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [256207] (6 PDB entries)

8. Domain d4bmoa_: 4bmo A: [251282]
   automated match to d2r2fa_
   complexed with cl, fe2, fmn

Details for d4bmoa_

PDB Entry: 4bmo, 1.81 Å

PDB Description: Crystal Structure of Bacillus cereus Ribonucleotide Reductase di- iron NrdF in Complex with NrdI (1.8 A resolution)

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4bmoa_:

Sequence; same for both SEQRES and ATOM records:

>d4bmoa_ a.25.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
mravnwnkkeddfslmfwkqniaqfwteeeiavssdkntwvqlskeeqiaykrvlggltl
ldtkqggegmplvlvhlenlqaksvlafmgameevhaksyshifttlateeeiddifdwv
dnhpllekkagiitsyyrrllkpevtkkelymamvasvflesylfysgffyplylagqgk
ltasgeiinliirdesihgvfvgilaqqifaelsaeeqqevqketqellmelyeiemayt
eeiytsiglvedvnrfvrynankglmnlglepkfeeeeinpivlnglrtd

Timeline for d4bmoa_:

• d4bmoa_ is new in SCOPe 2.04-stable
  
• d4bmoa_ appears in SCOPe 2.05
  
• d4bmoa_ appears in the current release, SCOPe 2.08