SCOPe 2.08: Domain d4bmgb_: 4bmg B:

Lineage for d4bmgb_ (4bmg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)

8. Domain d4bmgb_: 4bmg B: [251277]
   automated match to d3kxse_

Details for d4bmgb_

PDB Entry: 4bmg, 3 Å

PDB Description: crystal structure of hexameric hbc149 y132a

PDB Compounds: (B:) capsid protein

SCOPe Domain Sequences for d4bmgb_:

Sequence; same for both SEQRES and ATOM records:

>d4bmgb_ a.62.1.1 (B:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

Timeline for d4bmgb_:

• d4bmgb_ first appeared in SCOPe 2.04
  
• d4bmgb_ appears in SCOPe 2.07