Lineage for d4bmga_ (4bmg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494596Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 1494597Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 1494598Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 1494605Protein automated matches [191131] (2 species)
    not a true protein
  7. 1494606Species Hepatitis B virus [TaxId:10407] [256206] (1 PDB entry)
  8. 1494607Domain d4bmga_: 4bmg A: [251276]
    automated match to d3kxse_

Details for d4bmga_

PDB Entry: 4bmg (more details), 3 Å

PDB Description: crystal structure of hexameric hbc149 y132a
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d4bmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmga_ a.62.1.1 (A:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstlp

SCOPe Domain Coordinates for d4bmga_:

Click to download the PDB-style file with coordinates for d4bmga_.
(The format of our PDB-style files is described here.)

Timeline for d4bmga_: