![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
![]() | Protein automated matches [191104] (14 species) not a true protein |
![]() | Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries) |
![]() | Domain d4bm0a_: 4bm0 A: [251275] automated match to d4blka_ complexed with ca, hem |
PDB Entry: 4bm0 (more details), 2.2 Å
SCOPe Domain Sequences for d4bm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bm0a_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]} atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl sdveqacaetpfpaltadpgpvtsvppvp
Timeline for d4bm0a_: