Lineage for d4blna_ (4bln A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005953Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2005954Protein automated matches [191104] (11 species)
    not a true protein
  7. 2006021Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [235966] (11 PDB entries)
  8. 2006026Domain d4blna_: 4bln A: [251273]
    automated match to d4blka_
    complexed with ca, hem

Details for d4blna_

PDB Entry: 4bln (more details), 1.15 Å

PDB Description: crystal structure of fungal versatile peroxidase i from pleurotus ostreatus - crystal form iii
PDB Compounds: (A:) versatile peroxidase I

SCOPe Domain Sequences for d4blna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blna_ a.93.1.0 (A:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
atcadgrttanaaccvlfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiitfdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdtilarmgdagfsavevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtpdnkgevqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfagtmskmallgqdksklidcsdiiptppalvgaahlpagfsl
sdveqacaetpfpaltadpgpvtsvppvp

SCOPe Domain Coordinates for d4blna_:

Click to download the PDB-style file with coordinates for d4blna_.
(The format of our PDB-style files is described here.)

Timeline for d4blna_: