SCOPe 2.04: Domain d4bjoa_: 4bjo A:

Lineage for d4bjoa_ (4bjo A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (21 PDB entries)

8. Domain d4bjoa_: 4bjo A: [251267]
   automated match to d1suga_
   complexed with cl, edo, mg, no3

Details for d4bjoa_

PDB Entry: 4bjo, 2.06 Å

PDB Description: nitrate in the active site of ptp1b is a putative mimetic of the transition state

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d4bjoa_:

Sequence, based on SEQRES records:

>d4bjoa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgsemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdh
sriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvm
ekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhf
hyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclll
mdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

Sequence, based on observed residues (ATOM records):

>d4bjoa_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfsemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

Timeline for d4bjoa_:

• d4bjoa_ is new in SCOPe 2.04-stable
  
• d4bjoa_ appears in SCOPe 2.05
  
• d4bjoa_ appears in the current release, SCOPe 2.08, called d4bjoa1