SCOPe 2.04: Domain d4bj3b_: 4bj3 B:

Lineage for d4bj3b_ (4bj3 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein automated matches [190060] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (11 PDB entries)

8. Domain d4bj3b_: 4bj3 B: [251266]
   automated match to d1aoxb_
   complexed with btb, cl, mg

Details for d4bj3b_

PDB Entry: 4bj3, 3.04 Å

PDB Description: integrin alpha2 i domain e318w-collagen complex

PDB Compounds: (B:) Integrin alpha-2

SCOPe Domain Sequences for d4bj3b_:

Sequence, based on SEQRES records:

>d4bj3b_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
idvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktk
eemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsml
kavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdwaalle
kagtlgeqif

Sequence, based on observed residues (ATOM records):

>d4bj3b_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
idvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktk
eemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsml
kavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdwaallf

Timeline for d4bj3b_:

• d4bj3b_ is new in SCOPe 2.04-stable
  
• d4bj3b_ appears in SCOPe 2.05
  
• d4bj3b_ appears in the current release, SCOPe 2.08