Lineage for d1ptoh1 (1pto H:90-199)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1124186Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
    N-terminal domain in S2/S3 has C-lectin-like fold
  7. 1124187Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 1124198Domain d1ptoh1: 1pto H:90-199 [25126]
    Other proteins in same PDB: d1ptoa_, d1ptob2, d1ptoc2, d1ptod_, d1ptoe_, d1ptof_, d1ptog_, d1ptoh2, d1ptoi2, d1ptoj_, d1ptok_, d1ptol_

Details for d1ptoh1

PDB Entry: 1pto (more details), 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
PDB Compounds: (H:) pertussis toxin (subunit s2)

SCOPe Domain Sequences for d1ptoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptoh1 b.40.2.1 (H:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis [TaxId: 520]}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOPe Domain Coordinates for d1ptoh1:

Click to download the PDB-style file with coordinates for d1ptoh1.
(The format of our PDB-style files is described here.)

Timeline for d1ptoh1: