Lineage for d4bf4k_ (4bf4 K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2005933Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2005967Domain d4bf4k_: 4bf4 K: [251240]
    automated match to d4dnja_
    complexed with 17q, hem, so4; mutant

Details for d4bf4k_

PDB Entry: 4bf4 (more details), 2.7 Å

PDB Description: PikC D50N mutant in complex with the engineered cycloalkane substrate mimic bearing a termianl N,N-dimethylamino group
PDB Compounds: (K:) cytochrome p450 hydroxylase pikc

SCOPe Domain Sequences for d4bf4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bf4k_ a.104.1.0 (K:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
allercpdlaldvspgelvwypnpmirglkalpirwr

SCOPe Domain Coordinates for d4bf4k_:

Click to download the PDB-style file with coordinates for d4bf4k_.
(The format of our PDB-style files is described here.)

Timeline for d4bf4k_: