SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4bf4k_ (4bf4 K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (57 species)
    not a true protein
  7. 2005933Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2005967Domain d4bf4k_: 4bf4 K: [251240]
    automated match to d4dnja_
    complexed with 17q, hem, so4; mutant

Details for d4bf4k_

PDB Entry: 4bf4 (more details), 2.7 Å

PDB Description: PikC D50N mutant in complex with the engineered cycloalkane substrate mimic bearing a termianl N,N-dimethylamino group
PDB Compounds: (K:) cytochrome p450 hydroxylase pikc

SCOPe Domain Sequences for d4bf4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bf4k_ a.104.1.0 (K:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
asppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladpr
fskdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdg
lvdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqt
amaemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettv
nliangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvi
pagdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavr
allercpdlaldvspgelvwypnpmirglkalpirwr

SCOPe Domain Coordinates for d4bf4k_:

Click to download the PDB-style file with coordinates for d4bf4k_.
(The format of our PDB-style files is described here.)

Timeline for d4bf4k_: