Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries) |
Domain d4bf4a_: 4bf4 A: [251230] automated match to d4dnja_ complexed with 17q, hem, so4; mutant |
PDB Entry: 4bf4 (more details), 2.7 Å
SCOPe Domain Sequences for d4bf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bf4a_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]} sppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprf skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra llercpdlaldvspgelvwypnpmirglkalpirwr
Timeline for d4bf4a_: