SCOPe 2.07: Domain d4be9b_: 4be9 B:

Lineage for d4be9b_ (4be9 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Ophiostoma piceae [TaxId:61273] [256199] (3 PDB entries)

8. Domain d4be9b_: 4be9 B: [251227]
   Other proteins in same PDB: d4be9a2
   automated match to d4aqdb_
   complexed with 1pe, 7p9, gol, nag, no3, peg, pge

Details for d4be9b_

PDB Entry: 4be9, 2 Å

PDB Description: open conformation of o. piceae sterol esterase

PDB Compounds: (B:) sterol esterase

SCOPe Domain Sequences for d4be9b_:

Sequence; same for both SEQRES and ATOM records:

>d4be9b_ c.69.1.0 (B:) automated matches {Ophiostoma piceae [TaxId: 61273]}
ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpsc
pqmylstgngellfqlvgnliniplfqtatlssedcltlniqrpagttsnsslpvlfwif
gggfelgtnqyydgidlltegislgepfifvainyrvggfgflggkeikadgssnlglld
qrialewvadniasfggdpskvtiwgesagsisvfdqmalyggnnkykgkalfrggimns
gsvvpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyss
ialsylprpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqy
fqdlyfynatkeqltafvntyptditagspfntgifnelypgfkrlaailgdmtftlarr
aflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinf
vttgdpnkgaavdiqwpqwsakknilqiyatkavivadnfraksyeylynnigifri

Timeline for d4be9b_:

• d4be9b_ first appeared in SCOPe 2.04
  
• d4be9b_ appears in SCOPe 2.06
  
• d4be9b_ appears in the current release, SCOPe 2.08