Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Ophiostoma piceae [TaxId:61273] [256199] (3 PDB entries) |
Domain d4be9b_: 4be9 B: [251227] Other proteins in same PDB: d4be9a2 automated match to d4aqdb_ complexed with 1pe, 7p9, gol, nag, no3, peg, pge |
PDB Entry: 4be9 (more details), 2 Å
SCOPe Domain Sequences for d4be9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4be9b_ c.69.1.0 (B:) automated matches {Ophiostoma piceae [TaxId: 61273]} ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpsc pqmylstgngellfqlvgnliniplfqtatlssedcltlniqrpagttsnsslpvlfwif gggfelgtnqyydgidlltegislgepfifvainyrvggfgflggkeikadgssnlglld qrialewvadniasfggdpskvtiwgesagsisvfdqmalyggnnkykgkalfrggimns gsvvpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyss ialsylprpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqy fqdlyfynatkeqltafvntyptditagspfntgifnelypgfkrlaailgdmtftlarr aflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinf vttgdpnkgaavdiqwpqwsakknilqiyatkavivadnfraksyeylynnigifri
Timeline for d4be9b_: