Lineage for d4be9a1 (4be9 A:13-549)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136479Species Ophiostoma piceae [TaxId:61273] [256199] (3 PDB entries)
  8. 2136480Domain d4be9a1: 4be9 A:13-549 [251226]
    Other proteins in same PDB: d4be9a2
    automated match to d4aqdb_
    complexed with 1pe, 7p9, gol, nag, no3, peg, pge

Details for d4be9a1

PDB Entry: 4be9 (more details), 2 Å

PDB Description: Open conformation of O. piceae sterol esterase
PDB Compounds: (A:) sterol esterase

SCOPe Domain Sequences for d4be9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4be9a1 c.69.1.0 (A:13-549) automated matches {Ophiostoma piceae [TaxId: 61273]}
ttvnvnypegevvgvsvlgiesfrgvpfaqppvgnlrlkppvrytenigtkdttgigpsc
pqmylstgngellfqlvgnliniplfqtatlssedcltlniqrpagttsnsslpvlfwif
gggfelgtnqyydgidlltegislgepfifvainyrvggfgflggkeikadgssnlglld
qrialewvadniasfggdpskvtiwgesagsisvfdqmalyggnnkykgkalfrggimns
gsvvpaapvdgvkaqaiydhvvseagcagtsdtlaclrtvdytkfltavnsvpgivsyss
ialsylprpdgvvlidspeeivknkqyaavpmiigdqedegtlfavlpnnitstakivqy
fqdlyfynatkeqltafvntyptditagspfntgifnelypgfkrlaailgdmtftlarr
aflqlcsevnpdvpswsylasydygfpflgtfhatdilqvfygvlpnyasgsiqkyyinf
vttgdpnkgaavdiqwpqwsakknilqiyatkavivadnfraksyeylynnigifri

SCOPe Domain Coordinates for d4be9a1:

Click to download the PDB-style file with coordinates for d4be9a1.
(The format of our PDB-style files is described here.)

Timeline for d4be9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4be9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4be9b_