SCOP 1.69: Domain d1bcpc1: 1bcp C:90-199

Lineage for d1bcpc1 (1bcp C:90-199)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
   N-terminal domain in S2/S3 has C-lectin-like fold

7. Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)

8. Domain d1bcpc1: 1bcp C:90-199 [25121]
   Other proteins in same PDB: d1bcpa_, d1bcpb2, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph2, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_

Details for d1bcpc1

PDB Entry: 1bcp, 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpc1:

Sequence; same for both SEQRES and ATOM records:

>d1bcpc1 b.40.2.1 (C:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal
rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic

Timeline for d1bcpc1:

• d1bcpc1 first appeared (with stable ids) in SCOP 1.55
  
• d1bcpc1 appears in SCOP 1.67
  
• d1bcpc1 appears in SCOP 1.71
  
• d1bcpc1 appears in the current release, SCOPe 2.08