SCOPe 2.08: Domain d4bd8a_: 4bd8 A:

Lineage for d4bd8a_ (4bd8 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)

8. Domain d4bd8a_: 4bd8 A: [251206]
   automated match to d4bd7a_
   complexed with edo, pr

Details for d4bd8a_

PDB Entry: 4bd8, 2.22 Å

PDB Description: Bax domain swapped dimer induced by BimBH3 with CHAPS

PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d4bd8a_:

Sequence, based on SEQRES records:

>d4bd8a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseslkrigdel
dsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvp
elirtimgwtldflrerllgwiqdqggwdgllsyfgtptw

Sequence, based on observed residues (ATOM records):

>d4bd8a_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggptsseqimktgalllqgfiqdragrdastkklseslkrigdeldsnmelqrmiaavdt
dsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvpelirtimgwtldflr
erllgwiqdqggwdgllsyfgtptw

Timeline for d4bd8a_:

• d4bd8a_ first appeared in SCOPe 2.04
  
• d4bd8a_ appears in SCOPe 2.07