SCOPe 2.05: Domain d4bcjb2: 4bcj B:151-259

Lineage for d4bcjb2 (4bcj B:151-259)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.0: automated matches [227298] (1 protein)
   not a true family

6. Protein automated matches [227124] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries)

8. Domain d4bcjb2: 4bcj B:151-259 [251205]
   Other proteins in same PDB: d4bcja_
   automated match to d3mi9b2
   complexed with t9n

Details for d4bcjb2

PDB Entry: 4bcj, 3.16 Å

PDB Description: structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4bcjb2:

Sequence; same for both SEQRES and ATOM records:

>d4bcjb2 a.74.1.0 (B:151-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

Timeline for d4bcjb2:

• d4bcjb2 first appeared in SCOPe 2.04
  
• d4bcjb2 appears in SCOPe 2.06
  
• d4bcjb2 appears in the current release, SCOPe 2.08