Lineage for d4bcib2 (4bci B:151-259)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003956Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2003957Protein automated matches [227124] (1 species)
    not a true protein
  7. 2003958Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries)
  8. 2003974Domain d4bcib2: 4bci B:151-259 [251202]
    Other proteins in same PDB: d4bcia_
    automated match to d3mi9b2
    complexed with t3e

Details for d4bcib2

PDB Entry: 4bci (more details), 3.1 Å

PDB Description: structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4bcib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcib2 a.74.1.0 (B:151-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d4bcib2:

Click to download the PDB-style file with coordinates for d4bcib2.
(The format of our PDB-style files is described here.)

Timeline for d4bcib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bcib1
View in 3D
Domains from other chains:
(mouse over for more information)
d4bcia_